Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SELPLG Peptide - N-terminal region

SELPLG Peptide - N-terminal region

Product Specifications

Product Name Alternative

CD162, CLA, PSGL-1, PSGL1

UniProt

Q14242

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SELPLG Rabbit Polyclonal Antibody (orb586298) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002997

Preservative

Lyophilized powder

AA Sequence

GNSLQLWDTWADEAEKALGPLLARDRRQATEYEYLDYDFLPETEPPEMLR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Axl (phospho Tyr691) Polyclonal Antibody
RA22270-01 50 µL

Axl (phospho Tyr691) Polyclonal Antibody

Sign In for Pricing
View Details
Axl (phospho Tyr691) Polyclonal Antibody
RA22270-02 100 µL

Axl (phospho Tyr691) Polyclonal Antibody

Sign In for Pricing
View Details
Rat Monoclonal mouse LPAM-1 Antibody
orb1152974 100 µg

Rat Monoclonal mouse LPAM-1 Antibody

Sign In for Pricing
View Details
USP2, NT (USP2, UBP41, Ubiquitin carboxyl-terminal hydrolase 2, 41kD ubiquitin-specific protease, Deubiquitinating enzyme 2, Ubiquitin thioesterase 2, Ubiquitin-specific-processing protease 2) (MaxLight 750)
MBS6361881-01 0.1 mL

USP2, NT (USP2, UBP41, Ubiquitin carboxyl-terminal hydrolase 2, 41kD ubiquitin-specific protease, Deubiquitinating enzyme 2, Ubiquitin thioesterase 2, Ubiquitin-specific-processing protease 2) (MaxLight 750)

Sign In for Pricing
View Details
USP2, NT (USP2, UBP41, Ubiquitin carboxyl-terminal hydrolase 2, 41kD ubiquitin-specific protease, Deubiquitinating enzyme 2, Ubiquitin thioesterase 2, Ubiquitin-specific-processing protease 2) (MaxLight 750)
MBS6361881-02 5x 0.1 mL

USP2, NT (USP2, UBP41, Ubiquitin carboxyl-terminal hydrolase 2, 41kD ubiquitin-specific protease, Deubiquitinating enzyme 2, Ubiquitin thioesterase 2, Ubiquitin-specific-processing protease 2) (MaxLight 750)

Sign In for Pricing
View Details
ALG3 (NM_005787) Human Over-expression Lysate
LS010195-20ug 20 µg

ALG3 (NM_005787) Human Over-expression Lysate

Sign In for Pricing
View Details