Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCDC26 Peptide - C-terminal region

CCDC26 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MGC27434, RAM

UniProt

Q8TAB7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_659487

Preservative

Lyophilized powder

AA Sequence

VPINKYQRLVVKMKEEEALREKLNMQNITHKENQNAGSLEMIDNMLKQEE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bulk Anti-Human CD62L (DREG56) Antibody
ICH1017-5mg 5 mg

Bulk Anti-Human CD62L (DREG56) Antibody

Sign In for Pricing
View Details
Mammaglobin (SCGB2A2) (Breast Cancer Marker) (MGB1/2682R), CF405S conjugate, 0.1mg/mL
BNC042682-500 1x 500 µL

Mammaglobin (SCGB2A2) (Breast Cancer Marker) (MGB1/2682R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
8-Chloro-6-oxo-octanoic Acid Ethyl Ester
TRC-C374940-250MG 250 mg

8-Chloro-6-oxo-octanoic Acid Ethyl Ester

Sign In for Pricing
View Details
SERPINB8 Human qPCR Primer Pair (NM_002640)
HP231662 200 Reactions

SERPINB8 Human qPCR Primer Pair (NM_002640)

Sign In for Pricing
View Details
Tada2b Mouse Gene Knockout Kit (CRISPR)
KN517133 1 Kit

Tada2b Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SH2D1B (NM_053282) Human Recombinant Protein
TP305069L 1 mg

SH2D1B (NM_053282) Human Recombinant Protein

Sign In for Pricing
View Details