Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCDC26 Peptide - C-terminal region

CCDC26 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MGC27434, RAM

UniProt

Q8TAB7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_659487

Preservative

Lyophilized powder

AA Sequence

VPINKYQRLVVKMKEEEALREKLNMQNITHKENQNAGSLEMIDNMLKQEE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(2S)-2-Ethyl Ester-isocyanato-propanoic Acid
TRC-E548955-500MG 500 mg

(2S)-2-Ethyl Ester-isocyanato-propanoic Acid

Sign In for Pricing
View Details
PAGE GelRed® Nucleic Acid Gel Stain, 10,000X in Water
#41008-500uL 1x 500 µL

PAGE GelRed® Nucleic Acid Gel Stain, 10,000X in Water

Sign In for Pricing
View Details
Cytokeratin 8 (B22.1), 0.2mg/mL
BNUB1219-500 1x 500 µL

Cytokeratin 8 (B22.1), 0.2mg/mL

Sign In for Pricing
View Details
Cer1 Rabbit Polyclonal Antibody
HA500223 100 µL

Cer1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
RUNDC3B (NM_001134405) Human Over-expression Lysate
LC427421 20 µg

RUNDC3B (NM_001134405) Human Over-expression Lysate

Sign In for Pricing
View Details
Atp7a Mouse Gene Knockout Kit (CRISPR)
KN501829 1 Kit

Atp7a Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details