Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DUSP14 Peptide - C-terminal region

DUSP14 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MKP-L, MKP6

UniProt

O95147

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DUSP14 Rabbit Polyclonal Antibody (orb586308) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_008957

Preservative

Lyophilized powder

AA Sequence

PVIRPNVGFWRQLIDYERQLFGKSTVKMVQTPYGIVPDVYEKESRHLMPY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Buprenorphine (BUP) Rapid Test Device – Urine (10ng/mL)
D-DOA11D20 20 Tests

Buprenorphine (BUP) Rapid Test Device – Urine (10ng/mL)

Sign In for Pricing
View Details
Rabbit LILRB4 (Leukocyte Immunoglobulin Like Receptor Subfamily B Member 4) ELISA Kit
MBS2501292-01 24 Tests

Rabbit LILRB4 (Leukocyte Immunoglobulin Like Receptor Subfamily B Member 4) ELISA Kit

Sign In for Pricing
View Details
Rabbit LILRB4 (Leukocyte Immunoglobulin Like Receptor Subfamily B Member 4) ELISA Kit
MBS2501292-02 48 Tests

Rabbit LILRB4 (Leukocyte Immunoglobulin Like Receptor Subfamily B Member 4) ELISA Kit

Sign In for Pricing
View Details
Rabbit LILRB4 (Leukocyte Immunoglobulin Like Receptor Subfamily B Member 4) ELISA Kit
MBS2501292-03 96 Tests

Rabbit LILRB4 (Leukocyte Immunoglobulin Like Receptor Subfamily B Member 4) ELISA Kit

Sign In for Pricing
View Details
Rabbit LILRB4 (Leukocyte Immunoglobulin Like Receptor Subfamily B Member 4) ELISA Kit
MBS2501292-04 5x 96 Tests

Rabbit LILRB4 (Leukocyte Immunoglobulin Like Receptor Subfamily B Member 4) ELISA Kit

Sign In for Pricing
View Details
Rabbit LILRB4 (Leukocyte Immunoglobulin Like Receptor Subfamily B Member 4) ELISA Kit
MBS2501292-05 10x 96 Tests

Rabbit LILRB4 (Leukocyte Immunoglobulin Like Receptor Subfamily B Member 4) ELISA Kit

Sign In for Pricing
View Details