Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DUSP14 Peptide - C-terminal region

DUSP14 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MKP-L, MKP6

UniProt

O95147

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DUSP14 Rabbit Polyclonal Antibody (orb586308) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_008957

Preservative

Lyophilized powder

AA Sequence

PVIRPNVGFWRQLIDYERQLFGKSTVKMVQTPYGIVPDVYEKESRHLMPY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDCA7 Rabbit Polyclonal Antibody (HRP)
orb2090051 100 µL

CDCA7 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
Recombinant Coxiella burnetii Nucleoside diphosphate kinase (ndk)
MBS1408448-01 0.02 mg (E-Coli)

Recombinant Coxiella burnetii Nucleoside diphosphate kinase (ndk)

Sign In for Pricing
View Details
Recombinant Coxiella burnetii Nucleoside diphosphate kinase (ndk)
MBS1408448-02 0.1 mg (E-Coli)

Recombinant Coxiella burnetii Nucleoside diphosphate kinase (ndk)

Sign In for Pricing
View Details
Recombinant Coxiella burnetii Nucleoside diphosphate kinase (ndk)
MBS1408448-03 0.02 mg (Yeast)

Recombinant Coxiella burnetii Nucleoside diphosphate kinase (ndk)

Sign In for Pricing
View Details
Recombinant Coxiella burnetii Nucleoside diphosphate kinase (ndk)
MBS1408448-04 0.1 mg (Yeast)

Recombinant Coxiella burnetii Nucleoside diphosphate kinase (ndk)

Sign In for Pricing
View Details
Recombinant Coxiella burnetii Nucleoside diphosphate kinase (ndk)
MBS1408448-05 0.02 mg (Baculovirus)

Recombinant Coxiella burnetii Nucleoside diphosphate kinase (ndk)

Sign In for Pricing
View Details