Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FABP9 Peptide - middle region

FABP9 Peptide - middle region

Product Specifications

Product Name Alternative

PERF, PERF15, T-FABP

UniProt

Q0Z7S8

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FABP9 Rabbit Polyclonal Antibody (orb586313) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001073995

Preservative

Lyophilized powder

AA Sequence

SFKLGEEFDETTADNRKVKSTITLENGSMIHVQKWLGKETTIKRKIVDEK

More Discoveries

Explore Other Products

Browse additional items from our catalog

Oculocerebrorenal syndrome of Lowe (OCRL) polyclonal antibody
ABP-PAB-10923 100 ug

Oculocerebrorenal syndrome of Lowe (OCRL) polyclonal antibody

Sign In for Pricing
View Details
HRP-Linked Monoclonal Antibody to Trypsin (TRY)
MBS2106601-01 0.1 mL

HRP-Linked Monoclonal Antibody to Trypsin (TRY)

Sign In for Pricing
View Details
HRP-Linked Monoclonal Antibody to Trypsin (TRY)
MBS2106601-02 0.2 mL

HRP-Linked Monoclonal Antibody to Trypsin (TRY)

Sign In for Pricing
View Details
HRP-Linked Monoclonal Antibody to Trypsin (TRY)
MBS2106601-03 0.5 mL

HRP-Linked Monoclonal Antibody to Trypsin (TRY)

Sign In for Pricing
View Details
HRP-Linked Monoclonal Antibody to Trypsin (TRY)
MBS2106601-04 1 mL

HRP-Linked Monoclonal Antibody to Trypsin (TRY)

Sign In for Pricing
View Details
HRP-Linked Monoclonal Antibody to Trypsin (TRY)
MBS2106601-05 5 mL

HRP-Linked Monoclonal Antibody to Trypsin (TRY)

Sign In for Pricing
View Details