Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FABP9 Peptide - middle region

FABP9 Peptide - middle region

Product Specifications

Product Name Alternative

PERF, PERF15, T-FABP

UniProt

Q0Z7S8

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FABP9 Rabbit Polyclonal Antibody (orb586313) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001073995

Preservative

Lyophilized powder

AA Sequence

SFKLGEEFDETTADNRKVKSTITLENGSMIHVQKWLGKETTIKRKIVDEK

More Discoveries

Explore Other Products

Browse additional items from our catalog

hsa-miR-627-5p miRNA Mimic
MBS8298449-01 5 nmol

hsa-miR-627-5p miRNA Mimic

Sign In for Pricing
View Details
hsa-miR-627-5p miRNA Mimic
MBS8298449-02 10 nmol

hsa-miR-627-5p miRNA Mimic

Sign In for Pricing
View Details
hsa-miR-627-5p miRNA Mimic
MBS8298449-03 5x 10 nmol

hsa-miR-627-5p miRNA Mimic

Sign In for Pricing
View Details
ZNF248 Human siRNA Oligo Duplex (Locus ID 57209)
SR311421 1 Kit

ZNF248 Human siRNA Oligo Duplex (Locus ID 57209)

Sign In for Pricing
View Details
Glucomannokinase Antibody
MBS7149600 Inquire

Glucomannokinase Antibody

Sign In for Pricing
View Details
RN28S1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
39643061 1.0 µg DNA

RN28S1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details