Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPR84 Peptide - C-terminal region

GPR84 Peptide - C-terminal region

Product Specifications

Product Name Alternative

EX33, GPCR4

UniProt

Q9NQS5

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GPR84 Rabbit Polyclonal Antibody (orb586315) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_065103

Preservative

Lyophilized powder

AA Sequence

ATTQTLEGDSSEVGDQINSKRAKQMAEKSPPEASAKAQPIKGARRAPDSS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human VPS33A activation kit by CRISPRa
GA112232 1 Kit

Human VPS33A activation kit by CRISPRa

Sign In for Pricing
View Details
NDRG3 Antibody
8C18000-AAT 50 µg

NDRG3 Antibody

Sign In for Pricing
View Details
CNTN2 Mouse Monoclonal Antibody [Clone ID: X9A9]
AM03215PU-N 200 µg

CNTN2 Mouse Monoclonal Antibody [Clone ID: X9A9]

Sign In for Pricing
View Details
NIPA (Ab-354) Antibody
8B1164-AAT 50 µg

NIPA (Ab-354) Antibody

Sign In for Pricing
View Details
Cell Meter™ Intracellular GSH Assay Kit *Optimized for Flow Cytometry with 405 nm excitation*
22809-AAT 100 Tests

Cell Meter™ Intracellular GSH Assay Kit *Optimized for Flow Cytometry with 405 nm excitation*

Sign In for Pricing
View Details
24-epi-Castasterone
TRC-C226490-5MG 5 mg

24-epi-Castasterone

Sign In for Pricing
View Details