Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LYPD3 Peptide - C-terminal region

LYPD3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

C4.4A

UniProt

O95274

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LYPD3 Rabbit Polyclonal Antibody (orb586318) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055215

Preservative

Lyophilized powder

AA Sequence

SRDEEPRLTGGAAGHQDRSNSGQYPAKGGPQQPHNKGCVAPTAGLAALLL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPL10AP9 3'UTR Luciferase Stable Cell Line
TU020673 1.0 mL

RPL10AP9 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
KCNA2 (Potassium Voltage-Gated Channel Subfamily A Member 2)
483919 100 µL

KCNA2 (Potassium Voltage-Gated Channel Subfamily A Member 2)

Sign In for Pricing
View Details
S100P Antibody
MBS7126316-01 0.05 mL

S100P Antibody

Sign In for Pricing
View Details
S100P Antibody
MBS7126316-02 0.1 mL

S100P Antibody

Sign In for Pricing
View Details
S100P Antibody
MBS7126316-03 5x 0.1 mL

S100P Antibody

Sign In for Pricing
View Details
Sex Hormone Binding Globulin (SHBG) Monoclonal Antibody
CAU33268-01 100 µL

Sex Hormone Binding Globulin (SHBG) Monoclonal Antibody

Sign In for Pricing
View Details