Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LYPD3 Peptide - C-terminal region

LYPD3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

C4.4A

UniProt

O95274

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LYPD3 Rabbit Polyclonal Antibody (orb586318) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055215

Preservative

Lyophilized powder

AA Sequence

SRDEEPRLTGGAAGHQDRSNSGQYPAKGGPQQPHNKGCVAPTAGLAALLL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sult2a4 sgRNA CRISPR Lentivector (Mouse) (Target 2)
K4315903 1.0 µg DNA

Sult2a4 sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Recombinant Human Small ribosomal subunit protein mS33 (RT33)
orb3004442-01 20 µg

Recombinant Human Small ribosomal subunit protein mS33 (RT33)

Sign In for Pricing
View Details
Recombinant Human Small ribosomal subunit protein mS33 (RT33)
orb3004442-02 100 µg

Recombinant Human Small ribosomal subunit protein mS33 (RT33)

Sign In for Pricing
View Details
Recombinant Human Small ribosomal subunit protein mS33 (RT33)
orb3004442-03 1 mg

Recombinant Human Small ribosomal subunit protein mS33 (RT33)

Sign In for Pricing
View Details
Polyclonal PSMD12 Antibody
APR05546G 0.1ml

Polyclonal PSMD12 Antibody

Sign In for Pricing
View Details
TSPAN33 Protein Vector (Mouse) (pPM-C-His)
PV242417 500 ng

TSPAN33 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details