Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MOB1A Peptide - C-terminal region

MOB1A Peptide - C-terminal region

Product Specifications

Product Name Alternative

C2orf6, FLJ10788, FLJ11595, MATS1, MOB1, MOBK1B, Mob4B, MOBKL1B

UniProt

Q9H8S9

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MOB1A Rabbit Polyclonal Antibody (orb586320) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060691

Preservative

Lyophilized powder

AA Sequence

FDSVMQLQEEAHLNTSFKHFIFFVQEFNLIDRRELAPLQELIEKLGSKDR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Duffy Lentiviral Activation Particles (h)
sc-406288-LAC 200 µL

Duffy Lentiviral Activation Particles (h)

Sign In for Pricing
View Details
Dog/Canine Membrane IgA ELISA Kit
BG-CAN11596 1 Each

Dog/Canine Membrane IgA ELISA Kit

Sign In for Pricing
View Details
Table Top Spectrophotometer
LX201TS 1 Unit

Table Top Spectrophotometer

Sign In for Pricing
View Details
eIF2Bβ Double Nickase Plasmid (h)
sc-404686-NIC 20 µg

eIF2Bβ Double Nickase Plasmid (h)

Sign In for Pricing
View Details
T-Cell Surface Glycoprotein CD4 (CD4) Antibody (FITC)
abx139133 100 Tests

T-Cell Surface Glycoprotein CD4 (CD4) Antibody (FITC)

Sign In for Pricing
View Details
EPC1 Rabbit pAb (APR26119N)
APR26119N-01 50 µL

EPC1 Rabbit pAb (APR26119N)

Sign In for Pricing
View Details