Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PISD Peptide - C-terminal region

PISD Peptide - C-terminal region

Product Specifications

Product Name Alternative

DJ858B16, DKFZp566G2246, PSD, PSDC, PSSC, dJ858B16.2

UniProt

Q9UG56

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PISD Rabbit Polyclonal Antibody (orb586323) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055153

Preservative

Lyophilized powder

AA Sequence

WKHGFFSLTAVGATNVGSIRIYFDRDLHTNSPRHSKGSYNDFSFVTHTNR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human BDH2 sgRNA gene knockout kit - Lentiviral human BDH2 sgRNA gene knockout kit (plasmid)
GTR15361964 1 Vial

Lentiviral human BDH2 sgRNA gene knockout kit - Lentiviral human BDH2 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
RPSAP23 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K2065205 3x 1.0 µg

RPSAP23 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Cathepsin K (CTSK), Recombinant, Human, His-Tag
056617-01 10 µg

Cathepsin K (CTSK), Recombinant, Human, His-Tag

Sign In for Pricing
View Details
Cathepsin K (CTSK), Recombinant, Human, His-Tag
056617-02 50 µg

Cathepsin K (CTSK), Recombinant, Human, His-Tag

Sign In for Pricing
View Details
Cathepsin K (CTSK), Recombinant, Human, His-Tag
056617-03 100 µg

Cathepsin K (CTSK), Recombinant, Human, His-Tag

Sign In for Pricing
View Details
Cathepsin K (CTSK), Recombinant, Human, His-Tag
056617-04 200 µg

Cathepsin K (CTSK), Recombinant, Human, His-Tag

Sign In for Pricing
View Details