Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PISD Peptide - C-terminal region

PISD Peptide - C-terminal region

Product Specifications

Product Name Alternative

DJ858B16, DKFZp566G2246, PSD, PSDC, PSSC, dJ858B16.2

UniProt

Q9UG56

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PISD Rabbit Polyclonal Antibody (orb586324) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055153

Preservative

Lyophilized powder

AA Sequence

MCTEDLPFPPAASCDSFKNQLVTREGNELYHCVIYLAPGDYHCFHSPTDW

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EPB41 (NM_001166007) Human Tagged ORF Clone Lentiviral Particle
RC228487L3V 200 µL

EPB41 (NM_001166007) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Olfr1437 Protein Vector (Mouse) (pPM-C-His)
PV209357 500 ng

Olfr1437 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
Diamthazole hydrochloride
C8513-10 10 mg

Diamthazole hydrochloride

Sign In for Pricing
View Details
Mono (3-carboxy-2-ethylpropyl) Phthalate
sc-484954 2.5 mg

Mono (3-carboxy-2-ethylpropyl) Phthalate

Sign In for Pricing
View Details
Sterol carrier protein 2 (SCP2) (NM_001193599) Human Tagged ORF Clone Lentiviral Particle
RC231295L3V 200 µL

Sterol carrier protein 2 (SCP2) (NM_001193599) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
(-)-Riboflavin
TRC-R414995-25G 25 g

(-)-Riboflavin

Sign In for Pricing
View Details