Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PTGES2 Peptide - N-terminal region

PTGES2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

C9orf15, FLJ14038, GBF1, MGC11289, PGES2, mPGES-2, GBF-1

UniProt

A6NHH0

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PTGES2 Rabbit Polyclonal Antibody (orb331320) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_945176

Preservative

Lyophilized powder

AA Sequence

KEVTEFGNKYWLMLNEKEAQQVYGGKEARTEEMKWRQWADDWLVHLISPN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RNASEH2B Rabbit Polyclonal Antibody
TA361601 100 µL

RNASEH2B Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Beta-2-microglobulin (B2M) antibody *Mouse anti-human, monoclonal IgG2b*
V100015-AAT 50 µg

Anti-Beta-2-microglobulin (B2M) antibody *Mouse anti-human, monoclonal IgG2b*

Sign In for Pricing
View Details
PAX8 (Renal Cell Marker) (PAX8/1491), CF594 conjugate, 0.1mg/mL
BNC941491-500 1x 500 µL

PAX8 (Renal Cell Marker) (PAX8/1491), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
AGMAT Human Gene Knockout Kit (CRISPR)
KN402990 1 Kit

AGMAT Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
KLK6 Polyclonal Antibody
E-AB-11356-01 20 µL

KLK6 Polyclonal Antibody

Sign In for Pricing
View Details
KLK6 Polyclonal Antibody
E-AB-11356-02 60 µL

KLK6 Polyclonal Antibody

Sign In for Pricing
View Details