PTGES2 Peptide - N-terminal region
PTGES2 Peptide - N-terminal region
Product Specifications
Product Name Alternative
C9orf15, FLJ14038, GBF1, MGC11289, PGES2, mPGES-2, GBF-1
UniProt
A6NHH0
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with PTGES2 Rabbit Polyclonal Antibody (orb331320) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_945176
Preservative
Lyophilized powder
AA Sequence
KEVTEFGNKYWLMLNEKEAQQVYGGKEARTEEMKWRQWADDWLVHLISPN
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![Rb (RB1) Mouse Monoclonal Antibody [Clone ID: 7E4B8]](https://cdn.genprice.uk/products/937/68dd189a061270361e8fbc73/imageurl/am06100su-n.webp)
AM06100SU-N 100 µL
Rb (RB1) Mouse Monoclonal Antibody [Clone ID: 7E4B8]
Sign In for Pricing
View Details 
BNC880669-500 1x 500 µL
P27 / KIP1 (SX53G8), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details