Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC25A2 Peptide - C-terminal region

SLC25A2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MGC119151, MGC119153, ORC2, ORNT2

UniProt

Q9BXI2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SLC25A2 Rabbit Polyclonal Antibody (orb331322) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_114153

Preservative

Lyophilized powder

AA Sequence

VPGYFFFFGGYELSRSFFASGRSKDELGPVHLMLSGGVAGICLWLVVFPV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human NT-proBNP (N-Terminal Pro-Brain Natriuretic Peptide) ELISA Kit
E-EL-H6126-01 24 Tests

Human NT-proBNP (N-Terminal Pro-Brain Natriuretic Peptide) ELISA Kit

Sign In for Pricing
View Details
Human NT-proBNP (N-Terminal Pro-Brain Natriuretic Peptide) ELISA Kit
E-EL-H6126-02 48 Tests

Human NT-proBNP (N-Terminal Pro-Brain Natriuretic Peptide) ELISA Kit

Sign In for Pricing
View Details
Human NT-proBNP (N-Terminal Pro-Brain Natriuretic Peptide) ELISA Kit
E-EL-H6126-03 96 Tests

Human NT-proBNP (N-Terminal Pro-Brain Natriuretic Peptide) ELISA Kit

Sign In for Pricing
View Details
RICH2 (ARHGAP44) (C-term) Rabbit Polyclonal Antibody
AP53665PU-N 400 µL

RICH2 (ARHGAP44) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant ELK1 Antibody
RC-4670-01 50 μL

Recombinant ELK1 Antibody

Sign In for Pricing
View Details
Recombinant ELK1 Antibody
RC-4670-02 100 µL

Recombinant ELK1 Antibody

Sign In for Pricing
View Details