SLC25A2 Peptide - C-terminal region
SLC25A2 Peptide - C-terminal region
Product Specifications
Product Name Alternative
MGC119151, MGC119153, ORC2, ORNT2
UniProt
Q9BXI2
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SLC25A2 Rabbit Polyclonal Antibody (orb331322) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_114153
Preservative
Lyophilized powder
AA Sequence
VPGYFFFFGGYELSRSFFASGRSKDELGPVHLMLSGGVAGICLWLVVFPV
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
SPD-C5229-1mg 1 mg
SARS-CoV-2 Spike NTD Protein (C136F, Y144del, R190S, D215G, LA242-243del), His Tag (MALS verified)
Sign In for Pricing
View Details 
BNC470326-500 1x 500 µL
Serum Amyloid A (SAA/326), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
LC422445 20 µg
TRHDE-AS1 (NM_001025457) Human Over-expression Lysate
Sign In for Pricing
View Details