Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPAG1 Peptide - C-terminal region

SPAG1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

FLJ32920, HSD-3.8, SP75, TPIS

UniProt

Q07617

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SPAG1 Rabbit Polyclonal Antibody (orb586330) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003105

Preservative

Lyophilized powder

AA Sequence

KIEIQEVNEGKEEPGRPAGEVSMGCLASEKGGKSSRSPEDPEKLPIAKPN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Synaptophysin (SYP) (NM_003179) Human Recombinant Protein
TP762760 50 µg

Synaptophysin (SYP) (NM_003179) Human Recombinant Protein

Sign In for Pricing
View Details
Human FAM92A1 (FAM92A) activation kit by CRISPRa
GA115281 1 Kit

Human FAM92A1 (FAM92A) activation kit by CRISPRa

Sign In for Pricing
View Details
TGIF2LY (NM_139214) Human Recombinant Protein
TP321598L 1 mg

TGIF2LY (NM_139214) Human Recombinant Protein

Sign In for Pricing
View Details
ALK Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI9H5]
TA801325AM 100 µL

ALK Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI9H5]

Sign In for Pricing
View Details
HSPC302 (TBCK) (NM_001163436) Human Over-expression Lysate
LC431639 20 µg

HSPC302 (TBCK) (NM_001163436) Human Over-expression Lysate

Sign In for Pricing
View Details
Human WDR51B (POC1B) activation kit by CRISPRa
GA116969 1 Kit

Human WDR51B (POC1B) activation kit by CRISPRa

Sign In for Pricing
View Details