SPAG1 Peptide - C-terminal region
SPAG1 Peptide - C-terminal region
Product Specifications
Product Name Alternative
FLJ32920, HSD-3.8, SP75, TPIS
UniProt
Q07617
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SPAG1 Rabbit Polyclonal Antibody (orb586330) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_003105
Preservative
Lyophilized powder
AA Sequence
KIEIQEVNEGKEEPGRPAGEVSMGCLASEKGGKSSRSPEDPEKLPIAKPN
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC472176-500 1x 500 µL
MMP9 (rMMP9/1769), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
AP17119PU-N 400 µL
Apolipoprotein L 4 (APOL4) (Center) Rabbit Polyclonal Antibody
Sign In for Pricing
View Details ![PerCP/Cyanine5.5 Anti-Human CD21 Antibody[BU32]](https://cdn.genprice.uk/products/763/68dd149f061270361e7d0586/imageurl/e-ab-f1046j.webp)
E-AB-F1046J-01 20 Tests
PerCP/Cyanine5.5 Anti-Human CD21 Antibody[BU32]
Sign In for Pricing
View Details