Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STARD6 Peptide - N-terminal region

STARD6 Peptide - N-terminal region

Product Specifications

UniProt

P59095

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with STARD6 Rabbit Polyclonal Antibody (orb586333) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_631910

Preservative

Lyophilized powder

AA Sequence

NRDTSGWKVVKTSKKITVSSKASRKFHGNLYRVEGIIPESPAKLSDFLYQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-CD140b Antibody
CPA8643-01 30 µL

Anti-CD140b Antibody

Sign In for Pricing
View Details
Anti-CD140b Antibody
CPA8643-02 50 μL

Anti-CD140b Antibody

Sign In for Pricing
View Details
Anti-CD140b Antibody
CPA8643-03 100 µL

Anti-CD140b Antibody

Sign In for Pricing
View Details
Anti-CD140b Antibody
CPA8643-04 200 µL

Anti-CD140b Antibody

Sign In for Pricing
View Details
ZNF319, CT (ZNF319, KIAA1388, Zinc finger protein 319) (MaxLight 405) discontinued
044186-ML405 100 µL

ZNF319, CT (ZNF319, KIAA1388, Zinc finger protein 319) (MaxLight 405) discontinued

Sign In for Pricing
View Details
H-D-Orn(Boc)-OH
F-2845.0005 5.0g

H-D-Orn(Boc)-OH

Sign In for Pricing
View Details