Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TPP2 Peptide - N-terminal region

TPP2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

FLJ40359

UniProt

P29144

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TPP2 Rabbit Polyclonal Antibody (orb586336) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003282

Preservative

Lyophilized powder

AA Sequence

GAPGMQVTTDGKPKIVDIIDTTGSGDVNTATEVEPKDGEIVGLSGRVLKI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FITC-Linked Polyclonal Antibody to Chymase 1, Mast Cell (CMA1)
MBS2078268-01 0.1 mL

FITC-Linked Polyclonal Antibody to Chymase 1, Mast Cell (CMA1)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Chymase 1, Mast Cell (CMA1)
MBS2078268-02 0.2 mL

FITC-Linked Polyclonal Antibody to Chymase 1, Mast Cell (CMA1)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Chymase 1, Mast Cell (CMA1)
MBS2078268-03 0.5 mL

FITC-Linked Polyclonal Antibody to Chymase 1, Mast Cell (CMA1)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Chymase 1, Mast Cell (CMA1)
MBS2078268-04 1 mL

FITC-Linked Polyclonal Antibody to Chymase 1, Mast Cell (CMA1)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Chymase 1, Mast Cell (CMA1)
MBS2078268-05 5 mL

FITC-Linked Polyclonal Antibody to Chymase 1, Mast Cell (CMA1)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Chymase 1, Mast Cell (CMA1)
MBS2078268-06 5x 5 mL

FITC-Linked Polyclonal Antibody to Chymase 1, Mast Cell (CMA1)

Sign In for Pricing
View Details