Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TPP2 Peptide - N-terminal region

TPP2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

FLJ40359

UniProt

P29144

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TPP2 Rabbit Polyclonal Antibody (orb586336) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003282

Preservative

Lyophilized powder

AA Sequence

GAPGMQVTTDGKPKIVDIIDTTGSGDVNTATEVEPKDGEIVGLSGRVLKI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human OLIG3 (NM_175747) AAV Particle
RC208613A1V 250 µL

Human OLIG3 (NM_175747) AAV Particle

Sign In for Pricing
View Details
PPP1R3A Polyclonal Antibody
MBS9130623-01 0.02 mL

PPP1R3A Polyclonal Antibody

Sign In for Pricing
View Details
PPP1R3A Polyclonal Antibody
MBS9130623-02 0.1 mL

PPP1R3A Polyclonal Antibody

Sign In for Pricing
View Details
PPP1R3A Polyclonal Antibody
MBS9130623-03 5x 0.1 mL

PPP1R3A Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Human Lymphotoxin Alpha (TNF Superfamily, Member 1) (a. a. 171) Polypeptide
DAG330 20ug

Recombinant Human Lymphotoxin Alpha (TNF Superfamily, Member 1) (a. a. 171) Polypeptide

Sign In for Pricing
View Details
Aurora Kinase C (AURKC) Polyclonal Antibody
CAU24424-01 100 µL

Aurora Kinase C (AURKC) Polyclonal Antibody

Sign In for Pricing
View Details