Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDC25A Peptide - N-terminal region

CDC25A Peptide - N-terminal region

Product Specifications

Product Name Alternative

CDC25A2

UniProt

P30304

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CDC25A Rabbit Polyclonal Antibody (orb329769) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001780

Preservative

Lyophilized powder

AA Sequence

QLQGLGSDYEQPLEVKNNSNLQRMGSSESTDSGFCLDSPGPLDSKENLEN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Pongo abelii Beta-sarcoglycan (SGCB), partial
MBS1311082-01 0.5 mg (E-Coli)

Recombinant Pongo abelii Beta-sarcoglycan (SGCB), partial

Sign In for Pricing
View Details
Recombinant Pongo abelii Beta-sarcoglycan (SGCB), partial
MBS1311082-02 0.05 mg (Baculovirus)

Recombinant Pongo abelii Beta-sarcoglycan (SGCB), partial

Sign In for Pricing
View Details
Recombinant Pongo abelii Beta-sarcoglycan (SGCB), partial
MBS1311082-03 0.5 mg (Yeast)

Recombinant Pongo abelii Beta-sarcoglycan (SGCB), partial

Sign In for Pricing
View Details
Recombinant Pongo abelii Beta-sarcoglycan (SGCB), partial
MBS1311082-04 0.05 mg (Mammalian-Cell)

Recombinant Pongo abelii Beta-sarcoglycan (SGCB), partial

Sign In for Pricing
View Details
Recombinant Pongo abelii Beta-sarcoglycan (SGCB), partial
MBS1311082-05 1 mg (E-Coli)

Recombinant Pongo abelii Beta-sarcoglycan (SGCB), partial

Sign In for Pricing
View Details
Recombinant Pongo abelii Beta-sarcoglycan (SGCB), partial
MBS1311082-06 0.1 mg (Baculovirus)

Recombinant Pongo abelii Beta-sarcoglycan (SGCB), partial

Sign In for Pricing
View Details