Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDC25A Peptide - N-terminal region

CDC25A Peptide - N-terminal region

Product Specifications

Product Name Alternative

CDC25A2

UniProt

P30304

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CDC25A Rabbit Polyclonal Antibody (orb329769) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001780

Preservative

Lyophilized powder

AA Sequence

QLQGLGSDYEQPLEVKNNSNLQRMGSSESTDSGFCLDSPGPLDSKENLEN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Slc8a1 (NM_019268) Rat Tagged ORF Clone Lentiviral Particle
RR205452L3V 200 µL

Slc8a1 (NM_019268) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Mouse Monoclonal Carbonic Anhydrase IX/CA9 Antibody (SPM487) [DyLight 350]
NBP2-34411UV 0.1 mL

Mouse Monoclonal Carbonic Anhydrase IX/CA9 Antibody (SPM487) [DyLight 350]

Sign In for Pricing
View Details
SURF4 Human qPCR Primer Pair (NM_033161)
HP216341 200 Reactions

SURF4 Human qPCR Primer Pair (NM_033161)

Sign In for Pricing
View Details
CD32A (FCGR2A) Mouse Monoclonal Antibody [Clone ID: LBI13G9]
AMM09303V 100 µL

CD32A (FCGR2A) Mouse Monoclonal Antibody [Clone ID: LBI13G9]

Sign In for Pricing
View Details
Zfp39 siRNA Oligos set (Rat)
50953176 3x 5 nmol

Zfp39 siRNA Oligos set (Rat)

Sign In for Pricing
View Details
Rabbit anti-Schizosaccharomyces pombe (strain 972/24843)(Fission yeast) SPBC460.05 Polyclonal Antibody
MBS7172631 Inquire

Rabbit anti-Schizosaccharomyces pombe (strain 972/24843)(Fission yeast) SPBC460.05 Polyclonal Antibody

Sign In for Pricing
View Details