Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Scn1b Peptide - N-terminal region

Scn1b Peptide - N-terminal region

Product Specifications

UniProt

Q00954

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Scn1b Rabbit Polyclonal Antibody (orb575540) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_058984

Preservative

Lyophilized powder

AA Sequence

TFRQKGTEEFVKILRYENEVLQLEEDERFEGRVVWNGSRGTKDLQDLSIF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chlamydia trachomatis
MBS655278-01 1 mL

Chlamydia trachomatis

Sign In for Pricing
View Details
Chlamydia trachomatis
MBS655278-02 5x 1 mL

Chlamydia trachomatis

Sign In for Pricing
View Details
Recombinant Serratia proteamaculans Glycerol-3-phosphate acyltransferase (plsY)
MBS7026653-01 0.02 mg

Recombinant Serratia proteamaculans Glycerol-3-phosphate acyltransferase (plsY)

Sign In for Pricing
View Details
Recombinant Serratia proteamaculans Glycerol-3-phosphate acyltransferase (plsY)
MBS7026653-02 0.1 mg

Recombinant Serratia proteamaculans Glycerol-3-phosphate acyltransferase (plsY)

Sign In for Pricing
View Details
Recombinant Serratia proteamaculans Glycerol-3-phosphate acyltransferase (plsY)
MBS7026653-03 5x 0.1 mg

Recombinant Serratia proteamaculans Glycerol-3-phosphate acyltransferase (plsY)

Sign In for Pricing
View Details
SRFBP1 Blocking Peptide
33R-5104 0.1 mg

SRFBP1 Blocking Peptide

Sign In for Pricing
View Details