Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Scn1b Peptide - N-terminal region

Scn1b Peptide - N-terminal region

Product Specifications

UniProt

Q00954

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Scn1b Rabbit Polyclonal Antibody (orb575540) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_058984

Preservative

Lyophilized powder

AA Sequence

TFRQKGTEEFVKILRYENEVLQLEEDERFEGRVVWNGSRGTKDLQDLSIF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chicken A1-AGP ELISA Kit
ECKA0695 96 Tests

Chicken A1-AGP ELISA Kit

Sign In for Pricing
View Details
CHST13 antibody
MBS5301789-01 0.1 mL

CHST13 antibody

Sign In for Pricing
View Details
CHST13 antibody
MBS5301789-02 5x 0.1 mL

CHST13 antibody

Sign In for Pricing
View Details
Rabbit Anti-Human HKR1 Polyclonal Antibody
PA86146HU-01 50 µg

Rabbit Anti-Human HKR1 Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human HKR1 Polyclonal Antibody
PA86146HU-02 100 µg

Rabbit Anti-Human HKR1 Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human HKR1 Polyclonal Antibody
PA86146HU-03 500 µg

Rabbit Anti-Human HKR1 Polyclonal Antibody

Sign In for Pricing
View Details