Atat1 Peptide - middle region
Atat1 Peptide - middle region
Product Specifications
Product Name Alternative
3110080J08Rik, FLJ13158|Mec17|TAT
UniProt
Q6MG11
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Atat1 Rabbit Polyclonal Antibody (orb325028) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_997663
Preservative
Lyophilized powder
AA Sequence
WPLNRAPRRATPPAHPPPRSSSLGNSPDRGPLRPFVPEQELLRSLRLCPP
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
A1125-28C 100 µg
Akt2, Rat, Control Peptide (AKT-2, Protein Kinase Akt2, Protein Kinase B beta, PKB beta, PKBBeta, PRKBB, Rac Protein Kinase beta, RAC-BETA, RAC-beta Serine/threonine Protein Kinase, RAC-PK-beta, v-AKT Murine Thymoma Viral Oncogene Homolog 2)
Sign In for Pricing
View Details 142028 200 µL
Protein Kinase N2 (PKN2, PRK2, Pak-2, PRKCL2, Protein Kinase C-Like 2, Cardiolipin-Activated Protein Kinase Pak2)
Sign In for Pricing
View Details 
FAB19601F-100 100 Tests
Mouse Fc gamma RIII/CD16 Fluorescein MAb (Clone 275003)
Sign In for Pricing
View Details