Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Atat1 Peptide - middle region

Atat1 Peptide - middle region

Product Specifications

Product Name Alternative

3110080J08Rik, FLJ13158|Mec17|TAT

UniProt

Q6MG11

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Atat1 Rabbit Polyclonal Antibody (orb325028) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_997663

Preservative

Lyophilized powder

AA Sequence

WPLNRAPRRATPPAHPPPRSSSLGNSPDRGPLRPFVPEQELLRSLRLCPP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Stat5a (C-6) X
sc-271542 X 200 µg - 0.1 mL

Stat5a (C-6) X

Sign In for Pricing
View Details
Anti-GRB10 Antibody Picoband®
A01663-3 100 µg/Vial

Anti-GRB10 Antibody Picoband®

Sign In for Pricing
View Details
MYO10 Protein Lysate (Rat) with C-HA Tag
31274036 100 µg

MYO10 Protein Lysate (Rat) with C-HA Tag

Sign In for Pricing
View Details
Plant Phytic Acid (PC) ELISA Kit
SL0055PI-01 96 Tests

Plant Phytic Acid (PC) ELISA Kit

Sign In for Pricing
View Details
Plant Phytic Acid (PC) ELISA Kit
SL0055PI-02 48 Tests

Plant Phytic Acid (PC) ELISA Kit

Sign In for Pricing
View Details
NG2 (CSPG4) Human shRNA Plasmid Kit (Locus ID 1464)
TL313693 1 Kit

NG2 (CSPG4) Human shRNA Plasmid Kit (Locus ID 1464)

Sign In for Pricing
View Details