Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cxxc1 Peptide - N-terminal region

Cxxc1 Peptide - N-terminal region

Product Specifications

UniProt

A1A5S2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Cxxc1 Rabbit Polyclonal Antibody (orb578880) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001073166

Preservative

Lyophilized powder

AA Sequence

HGDCIRITEKMAKAIREWYCRECREKDPKLEIRYRHKKCRERDGSERDGS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SFTA3 (NM_001101341) Human Over-expression Lysate
LY426141 100 µg

SFTA3 (NM_001101341) Human Over-expression Lysate

Sign In for Pricing
View Details
Cofilin 1 (CFL1) pSer3 Rabbit Polyclonal Antibody
AP20933PU-N 100 µg

Cofilin 1 (CFL1) pSer3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CSNK1G2 Rabbit Polyclonal Antibody
AP20394PU-N 100 µg

CSNK1G2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Desacetyl Vindoline
TRC-D288745-25MG 25 mg

Desacetyl Vindoline

Sign In for Pricing
View Details
PAG (PAG1) (NM_018440) Human Over-expression Lysate
LC402686 20 µg

PAG (PAG1) (NM_018440) Human Over-expression Lysate

Sign In for Pricing
View Details
2,2’-(Ethanediyldiimino)bis-butanoic Acid(Mixture of Diastereomers)
TRC-E890340-500MG 500 mg

2,2’-(Ethanediyldiimino)bis-butanoic Acid(Mixture of Diastereomers)

Sign In for Pricing
View Details