Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

A2BP1 Peptide - N-terminal region

A2BP1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

FOX1, HRNBP1, 2BP1, A2BP1, FOX-1

UniProt

Q9NWB1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with A2BP1 Rabbit Polyclonal Antibody (orb583911) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001135805

Preservative

Lyophilized powder

AA Sequence

NCEREQLRGNQEAAAAPDTMAQPYASAQFAPPQNGIPAEYTAPHPHPAPE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Apolipoprotein L 1 (APOL1) Mouse Monoclonal Antibody [Clone ID: OTI1D8]
CF812042 100 µg

Apolipoprotein L 1 (APOL1) Mouse Monoclonal Antibody [Clone ID: OTI1D8]

Sign In for Pricing
View Details
Manual Wheelchair BHBD-902
BHBD-902 1 Unit

Manual Wheelchair BHBD-902

Sign In for Pricing
View Details
QORX Antibody
8C11167-AAT 50 µg

QORX Antibody

Sign In for Pricing
View Details
ICOS Mouse Monoclonal Antibody [Clone ID: OTI5H1]
CF813215 100 µg

ICOS Mouse Monoclonal Antibody [Clone ID: OTI5H1]

Sign In for Pricing
View Details
AARSD1 Antibody
KC-3850-01 50 μL

AARSD1 Antibody

Sign In for Pricing
View Details
AARSD1 Antibody
KC-3850-02 100 µL

AARSD1 Antibody

Sign In for Pricing
View Details