A2BP1 Peptide - N-terminal region
A2BP1 Peptide - N-terminal region
Product Specifications
Product Name Alternative
FOX1, HRNBP1, 2BP1, A2BP1, FOX-1
UniProt
Q9NWB1
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with A2BP1 Rabbit Polyclonal Antibody (orb583911) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001135805
Preservative
Lyophilized powder
AA Sequence
NCEREQLRGNQEAAAAPDTMAQPYASAQFAPPQNGIPAEYTAPHPHPAPE
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC740029-100 1x 100 µL
Fibronectin (TV-1), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
HA750955 100 µL
Casein Kinase 1 alpha Recombinant Rabbit monoclonal Antibody
Sign In for Pricing
View Details 
LC419406 20 µg
galectin 9 (LGALS9) (NM_002308) Human Over-expression Lysate
Sign In for Pricing
View Details