ATG13 Peptide - N-terminal region
ATG13 Peptide - N-terminal region
Product Specifications
Product Name Alternative
ATG13, FLJ20698, KIAA0652
UniProt
O75143
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ATG13 Rabbit Polyclonal Antibody (orb585952) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_055556
Preservative
Lyophilized powder
AA Sequence
MCVEISLKTSEGDSMELEIWCLEMNEKCDKEIKVSYTVYNRLSLLLKSLL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC940181-100 1x 100 µL
CD59 (heavy chain of Protectin) (BRA-10G), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880270-500 1x 500 µL
Fibronectin (HFN7.1), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040977-100 1x 100 µL
TGF-beta (1D11.16.8), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details