Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPR68 Peptide - middle region

GPR68 Peptide - middle region

Product Specifications

Product Name Alternative

MGC111379, MGC156983, OGR1, GPR12A

UniProt

Q15743

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GPR68 Rabbit Polyclonal Antibody (orb585966) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003476

Preservative

Lyophilized powder

AA Sequence

SIYFLMHEEVIEDENQHRVCFEHYPIQAWQRAINYYRFLVGFLFPICLLL

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDCA5 (6T5) Rabbit Monoclonal Antibody
AMRe08534-01 50 µL

CDCA5 (6T5) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
CDCA5 (6T5) Rabbit Monoclonal Antibody
AMRe08534-02 100 µL

CDCA5 (6T5) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
CDCA5 (6T5) Rabbit Monoclonal Antibody
AMRe08534-03 200 µL

CDCA5 (6T5) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Mouse Monoclonal Nuclear Membrane Marker Antibody (AE-5) [Alexa Fluor 350]
NBP3-11308AF350 0.1 mL

Mouse Monoclonal Nuclear Membrane Marker Antibody (AE-5) [Alexa Fluor 350]

Sign In for Pricing
View Details
APLF Polyclonal Antibody, HRP Conjugated
bs-12489R-HRP 100 µL

APLF Polyclonal Antibody, HRP Conjugated

Sign In for Pricing
View Details
Beta 2 Microglobulin Rabbit pAb
A1562-01 20 µL

Beta 2 Microglobulin Rabbit pAb

Sign In for Pricing
View Details