GPR68 Peptide - middle region
GPR68 Peptide - middle region
Product Specifications
Product Name Alternative
MGC111379, MGC156983, OGR1, GPR12A
UniProt
Q15743
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with GPR68 Rabbit Polyclonal Antibody (orb585966) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_003476
Preservative
Lyophilized powder
AA Sequence
SIYFLMHEEVIEDENQHRVCFEHYPIQAWQRAINYYRFLVGFLFPICLLL
More Discoveries
Explore Other Products
Browse additional items from our catalog
206379-01 48 Tests
Vascular Cell Adhesion Molecule 1 (VCAM-1) BioAssayTM ELISA Kit (Rabbit) discontinued
Sign In for Pricing
View Details 
206379-02 96 Tests
Vascular Cell Adhesion Molecule 1 (VCAM-1) BioAssayTM ELISA Kit (Rabbit) discontinued
Sign In for Pricing
View Details 
GTR10398608 96 Well
Sheep CDC42 small effector protein 2 (CDC42SE2) ELISA kit
Sign In for Pricing
View Details