Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

JAM2 Peptide - middle region

JAM2 Peptide - middle region

Product Specifications

Product Name Alternative

C21orf43, CD322, JAM-B, JAMB, PRO245, VE-JAM, VEJAM

UniProt

P57087

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with JAM2 Rabbit Polyclonal Antibody (orb585967) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_067042

Preservative

Lyophilized powder

AA Sequence

LVAPAVPSCEVPSSALSGTVVELRCQDKEGNPAPEYTWFKDGIRLLENPR

More Discoveries

Explore Other Products

Browse additional items from our catalog

GPR150 Polyclonal Antibody
RA25450-01 50 µL

GPR150 Polyclonal Antibody

Sign In for Pricing
View Details
GPR150 Polyclonal Antibody
RA25450-02 100 µL

GPR150 Polyclonal Antibody

Sign In for Pricing
View Details
UNG Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2F8]
TA503534BM 100 µL

UNG Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2F8]

Sign In for Pricing
View Details
Zfp354a Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
50930066 1.0 µg DNA

Zfp354a Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Recombinant CD8 Antibody (alpha chain) / Rabbit Monoclonal
orb386200-01 20 µg

Recombinant CD8 Antibody (alpha chain) / Rabbit Monoclonal

Sign In for Pricing
View Details
Recombinant CD8 Antibody (alpha chain) / Rabbit Monoclonal
orb386200-02 100 µg

Recombinant CD8 Antibody (alpha chain) / Rabbit Monoclonal

Sign In for Pricing
View Details