Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

JAM2 Peptide - middle region

JAM2 Peptide - middle region

Product Specifications

Product Name Alternative

C21orf43, CD322, JAM-B, JAMB, PRO245, VE-JAM, VEJAM

UniProt

P57087

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with JAM2 Rabbit Polyclonal Antibody (orb585967) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_067042

Preservative

Lyophilized powder

AA Sequence

LVAPAVPSCEVPSSALSGTVVELRCQDKEGNPAPEYTWFKDGIRLLENPR

More Discoveries

Explore Other Products

Browse additional items from our catalog

PLV3-U6-Gpr107-sgRNA1-Cas9-EGFP-Puro Plasmid
PVT71027 2 µg

PLV3-U6-Gpr107-sgRNA1-Cas9-EGFP-Puro Plasmid

Sign In for Pricing
View Details
COMMD9 HDR Plasmid (m)
sc-429351-HDR 20 µg

COMMD9 HDR Plasmid (m)

Sign In for Pricing
View Details
PNMT (NM_002686) Human Over-expression Lysate
LS005409-20ug 20 µg

PNMT (NM_002686) Human Over-expression Lysate

Sign In for Pricing
View Details
3-Bromo-1,2-benzoxazole
OR1021455 1 Each

3-Bromo-1,2-benzoxazole

Sign In for Pricing
View Details
IL-22 Monoclonal Antibody (Capture)
AN001240P-01 25 µg

IL-22 Monoclonal Antibody (Capture)

Sign In for Pricing
View Details
IL-22 Monoclonal Antibody (Capture)
AN001240P-02 100 µg

IL-22 Monoclonal Antibody (Capture)

Sign In for Pricing
View Details