Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FLNC Peptide - N-terminal region

FLNC Peptide - N-terminal region

Product Specifications

Product Name Alternative

ABP-280, ABP280A, ABPA, ABPL, FLJ10186, FLN2

UniProt

Q14315

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FLNC Rabbit Polyclonal Antibody (orb326498) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001120959

Preservative

Lyophilized powder

AA Sequence

VGKSADFVVEAIGTEVGTLGFSIEGPSQAKIECDDKGDGSCDVRYWPTEP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Colloidal Gold Conjugated Urtica dioica Lectin (Stinging Nettle) -UDA-, 1mL 20nm
GP-8005-20 1 mL

Colloidal Gold Conjugated Urtica dioica Lectin (Stinging Nettle) -UDA-, 1mL 20nm

Sign In for Pricing
View Details
ReadiUse™ Preactivated APC-Cy5.5 Tandem
2586-AAT 1 mg

ReadiUse™ Preactivated APC-Cy5.5 Tandem

Sign In for Pricing
View Details
Solid Block (for slides / machining)
BSW01 1 Each

Solid Block (for slides / machining)

Sign In for Pricing
View Details
Hexachloroethane
TRC-H290850-1G 1 g

Hexachloroethane

Sign In for Pricing
View Details
Recombinant Human SELL Protein (Fc Tag)
PDMH100191-01 20 µg

Recombinant Human SELL Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Human SELL Protein (Fc Tag)
PDMH100191-02 100 µg

Recombinant Human SELL Protein (Fc Tag)

Sign In for Pricing
View Details