Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KRT9 Peptide - C-terminal region

KRT9 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CK-9, EPPK, K9

UniProt

P35527

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KRT9 Rabbit Polyclonal Antibody (orb326500) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000217

Preservative

Lyophilized powder

AA Sequence

EIELQSQLSKKAALEKSLEDTKNRYCGQLQMIQEQISNLEAQITDVRQEI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TDT (Terminal Deoxynucleotidyl Transferase) Chicken ELISA Kit
H4946 96 Tests

TDT (Terminal Deoxynucleotidyl Transferase) Chicken ELISA Kit

Sign In for Pricing
View Details
ZFP36 Antibody (Center) Blocking Peptide
MBS9227679-01 0.5 mg

ZFP36 Antibody (Center) Blocking Peptide

Sign In for Pricing
View Details
ZFP36 Antibody (Center) Blocking Peptide
MBS9227679-02 5x 0.5 mg

ZFP36 Antibody (Center) Blocking Peptide

Sign In for Pricing
View Details
DDR1, phosphorylated (Tyr513)
399688-01 50 µL

DDR1, phosphorylated (Tyr513)

Sign In for Pricing
View Details
DDR1, phosphorylated (Tyr513)
399688-02 100 µL

DDR1, phosphorylated (Tyr513)

Sign In for Pricing
View Details
CCNB3 (Phospho-Ser284) (Rat) Rabbit pAb
MBS8551128-01 0.1 mL

CCNB3 (Phospho-Ser284) (Rat) Rabbit pAb

Sign In for Pricing
View Details