Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ANGPTL1 Peptide - N-terminal region

ANGPTL1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

ANG3, ANGPT3, ARP1, AngY, KIAA0351, UNQ162, dJ595C2.2

UniProt

O95841

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ANGPTL1 Rabbit Polyclonal Antibody (orb586011) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004664

Preservative

Lyophilized powder

AA Sequence

KINQRRYPRATDGKEEAKKCAYTFLVPEQRITGPICVNTKGQDASTIKDM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ELISA kit for Mouse GDF1 (Growth Differentiation Factor 1)
E-EL-M0596 96 Tests

ELISA kit for Mouse GDF1 (Growth Differentiation Factor 1)

Sign In for Pricing
View Details
Human Ferritin Matched Antibody Pair Set [ABP-S-05530]
ABP-S-05530 5 Plates

Human Ferritin Matched Antibody Pair Set [ABP-S-05530]

Sign In for Pricing
View Details
Human ETV4 knockout cell line
ABC-KH4954 1 Vial

Human ETV4 knockout cell line

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Fatty Acid Binding Protein 3, Muscle And Heart (FABP3)
MBS2053047-01 0.1 mL

HRP-Linked Polyclonal Antibody to Fatty Acid Binding Protein 3, Muscle And Heart (FABP3)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Fatty Acid Binding Protein 3, Muscle And Heart (FABP3)
MBS2053047-02 0.2 mL

HRP-Linked Polyclonal Antibody to Fatty Acid Binding Protein 3, Muscle And Heart (FABP3)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Fatty Acid Binding Protein 3, Muscle And Heart (FABP3)
MBS2053047-03 0.5 mL

HRP-Linked Polyclonal Antibody to Fatty Acid Binding Protein 3, Muscle And Heart (FABP3)

Sign In for Pricing
View Details