Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

G6PC3 Peptide - N-terminal region

G6PC3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

SCN4, UGRP

UniProt

Q9BUM1

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with G6PC3 Rabbit Polyclonal Antibody (orb586015) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_612396

Preservative

Lyophilized powder

AA Sequence

ESGYYSQAPAQVHQFPSSCETGPGSPSGHCMITGAALWPIMTALSSQVAT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DDA1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K0568606 1.0 µg DNA

DDA1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Mouse PSRC1 shRNA Plasmid
abx974889-01 150 µg

Mouse PSRC1 shRNA Plasmid

Sign In for Pricing
View Details
Mouse PSRC1 shRNA Plasmid
abx974889-02 300 µg

Mouse PSRC1 shRNA Plasmid

Sign In for Pricing
View Details
Anti-Lamin A + C/LMNA Antibody Picoband®, Carrier-free
PA1103-carrier-free 100 µg/Vial

Anti-Lamin A + C/LMNA Antibody Picoband®, Carrier-free

Sign In for Pricing
View Details
Rat Monoclonal Caspase-11 Antibody (4E11) [DyLight 488]
NBP2-80100G 0.1 mL

Rat Monoclonal Caspase-11 Antibody (4E11) [DyLight 488]

Sign In for Pricing
View Details
RPS29P27 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV785083 1.0 µg DNA

RPS29P27 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details