Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

G6PC3 Peptide - N-terminal region

G6PC3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

SCN4, UGRP

UniProt

Q9BUM1

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with G6PC3 Rabbit Polyclonal Antibody (orb586015) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_612396

Preservative

Lyophilized powder

AA Sequence

ESGYYSQAPAQVHQFPSSCETGPGSPSGHCMITGAALWPIMTALSSQVAT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DLX1 (Distal-less Homeobox 1, DLX 1, DLX-1, Homeobox Protein DLX1, OTTMUSP00000014202)
125891 50 µg

DLX1 (Distal-less Homeobox 1, DLX 1, DLX-1, Homeobox Protein DLX1, OTTMUSP00000014202)

Sign In for Pricing
View Details
Tiazofurin
sc-475805 5 mg

Tiazofurin

Sign In for Pricing
View Details
1- (3-Nitrobenzoyl) piperidine-4-carboxylic acid
OR15425 1 Each

1- (3-Nitrobenzoyl) piperidine-4-carboxylic acid

Sign In for Pricing
View Details
rno-miR-30e-5p miRNA Agomir
MBS8315262-01 5 nmol

rno-miR-30e-5p miRNA Agomir

Sign In for Pricing
View Details
rno-miR-30e-5p miRNA Agomir
MBS8315262-02 10 nmol

rno-miR-30e-5p miRNA Agomir

Sign In for Pricing
View Details
rno-miR-30e-5p miRNA Agomir
MBS8315262-03 20 nmol

rno-miR-30e-5p miRNA Agomir

Sign In for Pricing
View Details