CLASP2 Peptide - C-terminal region
CLASP2 Peptide - C-terminal region
Product Specifications
UniProt
O75122
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CLASP2 Rabbit Polyclonal Antibody (orb586052) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001193973
Preservative
Lyophilized powder
AA Sequence
VAVHAVIGDELKPHLSQLTGSKMKLLNLYIKRAQTGSGGADPTTDVSGQS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6189437-01 0.1 mL
CHEK2 (Serine/Threonine-protein Kinase Chk2, CHK2 Checkpoint Homolog, Cds1 Homolog, Hucds1, hCds1, Checkpoint Kinase 2, CDS1, CHK2, RAD53) (MaxLight 405)
Sign In for Pricing
View Details MBS6189437-02 5x 0.1 mL
CHEK2 (Serine/Threonine-protein Kinase Chk2, CHK2 Checkpoint Homolog, Cds1 Homolog, Hucds1, hCds1, Checkpoint Kinase 2, CDS1, CHK2, RAD53) (MaxLight 405)
Sign In for Pricing
View Details 
MBS2108187-01 0.1 mL
APC-Linked Polyclonal Antibody to Procollagen I N-Terminal Propeptide (PINP)
Sign In for Pricing
View Details MBS2108187-02 0.2 mL
APC-Linked Polyclonal Antibody to Procollagen I N-Terminal Propeptide (PINP)
Sign In for Pricing
View Details