Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CLASP2 Peptide - C-terminal region

CLASP2 Peptide - C-terminal region

Product Specifications

UniProt

O75122

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CLASP2 Rabbit Polyclonal Antibody (orb586052) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001193973

Preservative

Lyophilized powder

AA Sequence

VAVHAVIGDELKPHLSQLTGSKMKLLNLYIKRAQTGSGGADPTTDVSGQS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 8 (H1), CF568 conjugate, 0.1mg/mL
BNC680334-100 1x 100 µL

Cytokeratin 8 (H1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human Monocyte Chemotactic Protein 4 (MCP4) ELISA Kit
RD-MCP4-Hu-01 96 Tests

Human Monocyte Chemotactic Protein 4 (MCP4) ELISA Kit

Sign In for Pricing
View Details
Human Monocyte Chemotactic Protein 4 (MCP4) ELISA Kit
RD-MCP4-Hu-02 48 Tests

Human Monocyte Chemotactic Protein 4 (MCP4) ELISA Kit

Sign In for Pricing
View Details
(R)-1-Azido-3-[[3-fluoro-4-(morpholin-4-yl)phenyl]amino]propan-2-ol
TRC-A850155-5MG 5 mg

(R)-1-Azido-3-[[3-fluoro-4-(morpholin-4-yl)phenyl]amino]propan-2-ol

Sign In for Pricing
View Details
Apo-H Recombinant Rabbit Monoclonal Antibody [JE37-02]
HA721649 100 µL

Apo-H Recombinant Rabbit Monoclonal Antibody [JE37-02]

Sign In for Pricing
View Details
Malononitrile
TRC-M158020-10G 10 g

Malononitrile

Sign In for Pricing
View Details