Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

WWC1 Peptide - C-terminal region

WWC1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

FLJ10865, FLJ23369, HBEBP3, HBEBP36, KIAA0869, KIBRA

UniProt

Q8IX03

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with WWC1 Rabbit Polyclonal Antibody (orb586079) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_056053

Preservative

Lyophilized powder

AA Sequence

SRELKPVGVMAPASGPASTDAVSALLEQTAVELEKRQEGRSSTQTLEDSW

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal GluR5/GRIK1 Antibody [Alexa Fluor 532]
NBP1-76849AF532 0.1 mL

Rabbit Polyclonal GluR5/GRIK1 Antibody [Alexa Fluor 532]

Sign In for Pricing
View Details
GH (GHN, GH, GH-N, hGH-N, Growth hormone L, pituitary growth hormone) (MaxLight 550)
144570-ML550 100 µL

GH (GHN, GH, GH-N, hGH-N, Growth hormone L, pituitary growth hormone) (MaxLight 550)

Sign In for Pricing
View Details
Recombinant Human Cyclophilin G Protein, His, E.coli-25ug
QP10574-25ug 25ug

Recombinant Human Cyclophilin G Protein, His, E.coli-25ug

Sign In for Pricing
View Details
Chrysanthemi Extract
C14897-25mg 25 mg

Chrysanthemi Extract

Sign In for Pricing
View Details
Renvistobart (Biosimilar Reference Antibody) (TIGIT)
RA0736-01 100 µg

Renvistobart (Biosimilar Reference Antibody) (TIGIT)

Sign In for Pricing
View Details
Renvistobart (Biosimilar Reference Antibody) (TIGIT)
RA0736-02 1 mg

Renvistobart (Biosimilar Reference Antibody) (TIGIT)

Sign In for Pricing
View Details