Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

WWC1 Peptide - C-terminal region

WWC1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

FLJ10865, FLJ23369, HBEBP3, HBEBP36, KIAA0869, KIBRA

UniProt

Q8IX03

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with WWC1 Rabbit Polyclonal Antibody (orb586079) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_056053

Preservative

Lyophilized powder

AA Sequence

SRELKPVGVMAPASGPASTDAVSALLEQTAVELEKRQEGRSSTQTLEDSW

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Blocks, Ovary
CB602579 1 Block

Frozen Tissue Blocks, Ovary

Sign In for Pricing
View Details
CDC25B (human), (recombinant)
MBS566633-01 0.05 mg

CDC25B (human), (recombinant)

Sign In for Pricing
View Details
CDC25B (human), (recombinant)
MBS566633-02 5x 0.05 mg

CDC25B (human), (recombinant)

Sign In for Pricing
View Details
Human JMJD6 Protein Lysate
MBS8413814-01 0.02 mg

Human JMJD6 Protein Lysate

Sign In for Pricing
View Details
Human JMJD6 Protein Lysate
MBS8413814-02 5x 0.02 mg

Human JMJD6 Protein Lysate

Sign In for Pricing
View Details
MAFK (Transcription Factor MafK, Erythroid Transcription Factor NF-E2 p18 Subunit, MAFK) (MaxLight 405) discontinued
302543-ML405 100 µL

MAFK (Transcription Factor MafK, Erythroid Transcription Factor NF-E2 p18 Subunit, MAFK) (MaxLight 405) discontinued

Sign In for Pricing
View Details