Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BFSP2 Peptide - middle region

BFSP2 Peptide - middle region

Product Specifications

Product Name Alternative

CP47, CP49, LIFL-L, MGC142078, MGC142080, PHAKOSIN

UniProt

Q13515

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BFSP2 Rabbit Polyclonal Antibody (orb586104) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003562

Preservative

Lyophilized powder

AA Sequence

CQQVGEAVLENARLMLQTETIQAGADDFKERYENEQPFRKAAEEEINSLY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LDN-212854 5mg
A12821-5 5 mg

LDN-212854 5mg

Sign In for Pricing
View Details
(S) -2-Bromoheptane
OR1046380-01 100 mg

(S) -2-Bromoheptane

Sign In for Pricing
View Details
(S) -2-Bromoheptane
OR1046380-02 250 mg

(S) -2-Bromoheptane

Sign In for Pricing
View Details
(S) -2-Bromoheptane
OR1046380-03 1 g

(S) -2-Bromoheptane

Sign In for Pricing
View Details
CD1C
CSB-CL004891HU2 10 μg Plasmid + 200 μL Glycerol

CD1C

Sign In for Pricing
View Details
Src (Phospho-Tyr419) Rabbit mAb
AB100335 100 µL

Src (Phospho-Tyr419) Rabbit mAb

Sign In for Pricing
View Details