Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PTH2R Peptide - C-terminal region

PTH2R Peptide - C-terminal region

Product Specifications

Product Name Alternative

PTHR2

UniProt

P49190

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PTH2R Rabbit Polyclonal Antibody (orb586109) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005039

Preservative

Lyophilized powder

AA Sequence

NSEQDCLPHSFHEETKEDSGRQGDDILMEKPSRPMESNPDTEGCQGETED

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IRAK4 Antibody, mAb, Rabbit
A03725-50 50 µL

IRAK4 Antibody, mAb, Rabbit

Sign In for Pricing
View Details
Monoclonal CD34 Antibody (monoclonal) (M01), Clone: 5F3
AMM03341G 0.1mg

Monoclonal CD34 Antibody (monoclonal) (M01), Clone: 5F3

Sign In for Pricing
View Details
Rpl41 (NM_139083) Rat Tagged ORF Clone Lentiviral Particle
RR202482L4V 200 µL

Rpl41 (NM_139083) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Interleukin 2 Receptor alpha, Soluble (IL-2 sRa) (MaxLight 650)
I7663-31H-ML650 100 µL

Interleukin 2 Receptor alpha, Soluble (IL-2 sRa) (MaxLight 650)

Sign In for Pricing
View Details
IQGAP1 (IQ Motif Containing GTPase Activating Protein 1, SAR1, p195, HUMORFA01, KIAA0051)
321040-01 50 µg

IQGAP1 (IQ Motif Containing GTPase Activating Protein 1, SAR1, p195, HUMORFA01, KIAA0051)

Sign In for Pricing
View Details
IQGAP1 (IQ Motif Containing GTPase Activating Protein 1, SAR1, p195, HUMORFA01, KIAA0051)
321040-02 100 µg

IQGAP1 (IQ Motif Containing GTPase Activating Protein 1, SAR1, p195, HUMORFA01, KIAA0051)

Sign In for Pricing
View Details