ARPC1B Peptide - middle region
ARPC1B Peptide - middle region
Product Specifications
Product Name Alternative
ARC41, p40-ARC, p41-ARC
UniProt
O15143
Field of Research
Musculoskeletal & Connective Tissue Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ARPC1B Rabbit Polyclonal Antibody (orb586342) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_005711
Preservative
Lyophilized powder
AA Sequence
KKPIRSTVLSLDWHPNNVLLAAGSCDFKCRIFSAYIKEVEERPAPTPWGS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6284477-01 0.1 mL
CDK7, ID (Cell division protein kinase 7, CDK-activating kinase, CAK, TFIIH basal transcription factor complex kinase subunit, 39kD protein kinase, P39 Mo15, STK1, CAK1, CDK7, MO15,) (MaxLight 750)
Sign In for Pricing
View Details MBS6284477-02 5x 0.1 mL
CDK7, ID (Cell division protein kinase 7, CDK-activating kinase, CAK, TFIIH basal transcription factor complex kinase subunit, 39kD protein kinase, P39 Mo15, STK1, CAK1, CDK7, MO15,) (MaxLight 750)
Sign In for Pricing
View Details ![Ethyl 5-chlorothiazolo[5,4-b]pyridine-2-carboxylate](https://cdn.genprice.uk/genprice/uk/genprice2.webp)
OR78883-01 100 mg
Ethyl 5-chlorothiazolo[5,4-b]pyridine-2-carboxylate
Sign In for Pricing
View Details OR78883-02 250 mg
Ethyl 5-chlorothiazolo[5,4-b]pyridine-2-carboxylate
Sign In for Pricing
View Details