Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DNAH9 Peptide - C-terminal region

DNAH9 Peptide - C-terminal region

Product Specifications

Product Name Alternative

DNAH17L, DNEL1, DYH9, Dnahc9, HL-20, HL20, KIAA0357

UniProt

A2VCQ8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DNAH9 Rabbit Polyclonal Antibody (orb586345) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

IHC, WB

NCBI Accession Number

NP_004653

Preservative

Lyophilized powder

AA Sequence

DSQARDGAGATREEKVKALLEEILERVTDEFNIPELMAKVEERTPYIVVA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HypoGel® 400 COOH
SP40011015003.5G 5 g

HypoGel® 400 COOH

Sign In for Pricing
View Details
(2S)-2-(2,5-Dioxo-3-propylpyrrolidin-1-yl)butanamide
TRC-D718300-50MG 50 mg

(2S)-2-(2,5-Dioxo-3-propylpyrrolidin-1-yl)butanamide

Sign In for Pricing
View Details
ATP5D Antibody
8C14592-AAT 50 µg

ATP5D Antibody

Sign In for Pricing
View Details
RNF89 (TRIM6) (NM_058166) Human Over-expression Lysate
LY403302 100 µg

RNF89 (TRIM6) (NM_058166) Human Over-expression Lysate

Sign In for Pricing
View Details
Human WFDC9 activation kit by CRISPRa
GA116911 1 Kit

Human WFDC9 activation kit by CRISPRa

Sign In for Pricing
View Details
Tissue Total RNA, Colon
CR562890 5 µg

Tissue Total RNA, Colon

Sign In for Pricing
View Details