Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DNAH9 Peptide - C-terminal region

DNAH9 Peptide - C-terminal region

Product Specifications

Product Name Alternative

DNAH17L, DNEL1, DYH9, Dnahc9, HL-20, HL20, KIAA0357

UniProt

A2VCQ8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DNAH9 Rabbit Polyclonal Antibody (orb586345) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

IHC, WB

NCBI Accession Number

NP_004653

Preservative

Lyophilized powder

AA Sequence

DSQARDGAGATREEKVKALLEEILERVTDEFNIPELMAKVEERTPYIVVA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Asialoglycoprotein Receptor 2 (ASGR2) ELISA Kit
RD-ASGR2-Hu-01 96 Tests

Human Asialoglycoprotein Receptor 2 (ASGR2) ELISA Kit

Sign In for Pricing
View Details
Human Asialoglycoprotein Receptor 2 (ASGR2) ELISA Kit
RD-ASGR2-Hu-02 48 Tests

Human Asialoglycoprotein Receptor 2 (ASGR2) ELISA Kit

Sign In for Pricing
View Details
Polystyrene A CHO
HA110006.100G 100 g

Polystyrene A CHO

Sign In for Pricing
View Details
KLF12 Rabbit Polyclonal Antibody
TA370900 100 µL

KLF12 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human USP45 activation kit by CRISPRa
GA113829 1 Kit

Human USP45 activation kit by CRISPRa

Sign In for Pricing
View Details
Human IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (IGHM/3776R), CF640R conjugate, 0.1mg/mL
BNC403776-100 1x 100 µL

Human IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (IGHM/3776R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details